Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502008

Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E1B-AP5, E1BAP5, HNRPUL1, E130317O14Rik, Hnrnpul, Hnrpul1, hnrpul1, zgc:85971, wu:fb53d10, wu:fk45c03
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502008
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HNRPUL1 antibody: synthetic peptide directed towards the middle region of human HNRPUL1
Sequence LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPE KRFDNRGGGG
Predicted Reactivity Rat :100%,   Dog :100%,   Zebrafish :100%,   Crab-eating macaque :100%,   Mouse :100%,   Human :100%,   Bovine :92%,   Atlantic salmon :92%,  
Characteristics This is a rabbit polyclonal antibody against HNRPUL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HNRPUL1
Background HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function
Molecular Weight 85kDa
Gene ID 11100
NCBI Accession NP_653333, NM_144732
UniProt Q9BUJ2-4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HNRPUL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1)", type "Antibodies"
Hosts (19), (1)
Reactivities (17), (4), (3), (1), (1)
Applications (20), (8), (6), (4), (2), (2), (2), (1), (1), (1), (1)
Epitopes (5), (1), (1), (1), (1)
Beacon