Did you know that you can buy products from over 140 different suppliers from us?

Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1) (Middle Region) antibody

Details for Product No. ABIN502008
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HNRPUL1, E1B-AP5, E1BAP5, E130317O14Rik, Hnrnpul, Hnrpul1, hnrpul1, wu:fb53d10, wu:fk45c03, zgc:85971
Epitope
Middle Region
(6), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Human
(18), (5), (4), (1), (1)
Host
Rabbit
(20), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(20), (8), (8), (5), (4), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502008
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HNRPUL1
Sequence LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPE KRFDNRGGGG
Predicted Reactivity Rat :100 %,   Dog :100 %,   Zebrafish :100 %,   Crab-eating macaque :100 %,   Mouse :100 %,   Human :100 %,   Bovine :90 %,   Atlantic salmon :90 %,  
Characteristics This is a rabbit polyclonal antibody against HNRPUL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HNRPUL1
Background HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function
Molecular Weight 85 kDa
Gene ID 11100
NCBI Accession NM_144732, NP_653333
UniProt Q9BUJ2-4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 756 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1) (Middle Region) antibody WB Suggested Anti-HNRPUL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top