Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502039

IMP3, U3 Small Nucleolar Ribonucleoprotein, Homolog (Yeast) (IMP3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BRMS2, C15orf12, MRPS4, AI256594, 1190002L16Rik, RGD1306825, zgc:56526
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN502039
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IMP3 antibody: synthetic peptide directed towards the middle region of human IMP3
Sequence GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEY NEERDDFDLE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, African clawed frog : 85%, Chicken : 81%, Zebrafish : 78%  
Characteristics This is a rabbit polyclonal antibody against IMP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IMP3
Background This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
Molecular Weight 22kDa
Gene ID 55272
NCBI Accession NP_060755, NM_018285
UniProt Q9NV31
Research Area Cancer, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IMP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ma, Jin, Liu et al.: "[Comparison of 3 hand-carried ultrasound devices with comprehensive echocardiographic devices in elderly cardiac inpatient examinations]." in: Zhongguo yi liao qi xie za zhi = Chinese journal of medical instrumentation, Vol. 32, Issue 4, pp. 304-7, 2008 (PubMed).

Background publications Zheng, Yi, Fadare et al.: "The oncofetal protein IMP3: a novel biomarker for endometrial serous carcinoma." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 304-15, 2008 (PubMed).

Alternatives for antigen "IMP3, U3 Small Nucleolar Ribonucleoprotein, Homolog (Yeast) (IMP3)", type "Antibodies"
Hosts (21), (3)
Reactivities (22), (18), (15), (14), (12), (1)
Applications (15), (10), (10), (6), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1)
Beacon