IMP3, U3 Small Nucleolar Ribonucleoprotein, Homolog (Yeast) (IMP3) (Middle Region) antibody

Details for Product No. ABIN502039
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BRMS2, C15orf12, MRPS4, AI256594, 1190002L16Rik, RGD1306825, zgc:56526
Epitope
Middle Region
(3), (3), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(25), (17), (15), (14), (12), (1)
Host
Rabbit
(21), (3), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (10), (9), (6), (4), (2)
Pubmed 2 references available
Catalog no. ABIN502039
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human IMP3
Sequence GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEY NEERDDFDLE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 80 %, Chicken : 80 %, Zebrafish : 70 %  
Characteristics This is a rabbit polyclonal antibody against IMP3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name IMP3
Background This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
Molecular Weight 22 kDa
Gene ID 55272
NCBI Accession NM_018285, NP_060755
UniProt Q9NV31
Research Area Cancer, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 184 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-IMP3, U3 Small Nucleolar Ribonucleoprotein, Homolog (Yeast) (IMP3) (Middle Region) antibody WB Suggested Anti-IMP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Product cited in: Ma, Jin, Liu et al.: "[Comparison of 3 hand-carried ultrasound devices with comprehensive echocardiographic devices in elderly cardiac inpatient examinations]." in: Zhongguo yi liao qi xie za zhi = Chinese journal of medical instrumentation, Vol. 32, Issue 4, pp. 304-7, 2008 (PubMed).

Background publications Zheng, Yi, Fadare et al.: "The oncofetal protein IMP3: a novel biomarker for endometrial serous carcinoma." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 304-15, 2008 (PubMed).

Hosts (21), (3), (3)
Reactivities (25), (17), (15), (14), (12), (1)
Applications (18), (10), (9), (6), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2), (2), (1)
back to top