Did you know that you can buy products from over 140 different suppliers from us?

Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibody

Details for Product No. ABIN502053
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MTHFSD, DKFZp469G0629, fc43c12, si:dkey-199i24.1, wu:fc43c12, zgc:153374, AW049977, BC052066, C920004D05
Epitope
N-Term
(11), (7), (2)
Reactivity
Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(12), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (6), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502053
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MTHFSD
Sequence MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFK GSYLACQNIK
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Pig : 90 %, Chicken : 90 %, Zebrafish : 90 %, Guinea pig : 70 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against MTHFSD. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MTHFSD
Background The function remains unknows.
Molecular Weight 42 kDa
Gene ID 64779
NCBI Accession NM_022764, NP_073601
UniProt B7ZLC0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 382 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibody WB Suggested Anti-MTHFSD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top