Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502053

Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW049977, BC052066, C920004D05, fc43c12, si:dkey-199i24.1, wu:fc43c12, zgc:153374, MTHFSD, DKFZp469G0629
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTHFSD antibody: synthetic peptide directed towards the N terminal of human MTHFSD
Sequence MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFK GSYLACQNIK
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Pig : 92%, Chicken : 90%, Zebrafish : 90%, Guinea pig : 78%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against MTHFSD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTHFSD
Background The function remains unknows.
Molecular Weight 42kDa
Gene ID 64779
NCBI Accession NP_073601, NM_022764
UniProt B7ZLC0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTHFSD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Methenyltetrahydrofolate Synthetase Domain Containing (MTHFSD)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1), (1), (1), (1)
Applications (8), (3)
Epitopes (6), (2), (1)
Beacon