Did you know that you can buy products from over 140 different suppliers from us?

Ketohexokinase (KHK) (N-Term) antibody

Details for Product No. ABIN502141
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms wu:fj68h03, zgc:92219, zgc:92626, KHK, khk, KETHPRO
Epitope
N-Term
(12), (11), (8), (6), (2), (2), (2), (1), (1)
Reactivity
Human
(69), (23), (15), (13), (12), (1)
Host
Rabbit
(48), (22), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(55), (26), (15), (13), (10), (9), (7), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502141
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KHK
Sequence FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTI VLHDTSLPDV
Predicted Reactivity Human : 100 %, Bovine : 70 %, Dog : 70 %, Guinea pig : 70 %
Characteristics This is a rabbit polyclonal antibody against KHK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KHK
Background KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.
Molecular Weight 32 kDa
Gene ID 3795
NCBI Accession NM_006488, NP_006479
UniProt P50053-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 298 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top