Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502141

Ketohexokinase (KHK) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KETHPRO, wu:fj68h03, zgc:92219, zgc:92626, KHK, khk
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502141
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK
Sequence FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTI VLHDTSLPDV
Predicted Reactivity Human : 100%, Bovine : 78%, Dog : 78%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against KHK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KHK
Background KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.
Molecular Weight 32kDa
Gene ID 3795
NCBI Accession NP_006479, NM_006488
UniProt P50053-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KHK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Ketohexokinase (KHK)", type "Antibodies"
Hosts (34), (22), (1)
Reactivities (55), (25), (15), (13), (12), (1)
Applications (42), (17), (15), (13), (10), (8), (7), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (6), (5), (2), (2), (2)
Beacon