Did you know that you can buy products from over 140 different suppliers from us?

Laminin, beta 3 (LAMB3) (Middle Region) antibody

Details for Product No. ABIN502158
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BM600-125KDA, LAM5, LAMNB1, LAMB3, lam5, lamnb1
Epitope
Middle Region
(6), (3), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(27), (3), (1)
Host
Rabbit
(15), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (23), (13), (12), (7), (6), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502158
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LAMB3
Sequence ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGE TMEMMDRMKD
Predicted Reactivity Human : 100 %, Bovine : 80 %, Guinea pig : 80 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against LAMB3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LAMB3
Background The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bul
Molecular Weight 128 kDa
Gene ID 3914
NCBI Accession NM_000228, NP_000219
UniProt Q13751
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1172 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Laminin, beta 3 (LAMB3) (Middle Region) antibody WB Suggested Anti-LAMB3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
Background publications Pasmooij, Pas, Bolling et al.: "Revertant mosaicism in junctional epidermolysis bullosa due to multiple correcting second-site mutations in LAMB3." in: The Journal of clinical investigation, Vol. 117, Issue 5, pp. 1240-8, 2007 (PubMed).

Hosts (15), (15)
Reactivities (27), (3), (1)
Applications (23), (23), (13), (12), (7), (6), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502158
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top