Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502158

Laminin, beta 3 (LAMB3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BM600-125KDA, LAM5, LAMNB1, LAMB3, lam5, lamnb1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502158
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3
Sequence ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGE TMEMMDRMKD
Predicted Reactivity Human : 100%, Bovine : 85%, Guinea pig : 85%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against LAMB3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LAMB3
Background The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bul
Molecular Weight 128kDa
Gene ID 3914
NCBI Accession NP_000219, NM_000228
UniProt Q13751
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LAMB3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pasmooij, Pas, Bolling et al.: "Revertant mosaicism in junctional epidermolysis bullosa due to multiple correcting second-site mutations in LAMB3." in: The Journal of clinical investigation, Vol. 117, Issue 5, pp. 1240-8, 2007 (PubMed).

Alternatives for antigen "Laminin, beta 3 (LAMB3)", type "Antibodies"
Hosts (9), (7)
Reactivities (15), (1)
Applications (13), (11), (9), (4), (2), (1)
Epitopes (3), (2), (1)
Beacon