Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502267

Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2700038P16Rik, C80053, GatA, wu:fi03b10, 0929/02, CG6007, Dmel\\CG6007, bene, benedict, l(3)S092902
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502267
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-QRSL1 antibody: synthetic peptide directed towards the N terminal of human QRSL1
Sequence SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAF TCYAALGSDT
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against QRSL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name QRSL1
Background The function of the QRSL1 protein remains unknown.
Molecular Weight 57kDa
Gene ID 55278
NCBI Accession NP_060762, NM_018292
UniProt Q9H0R6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-QRSL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1)", type "Antibodies"
Hosts (10), (1)
Reactivities (9), (3), (3), (1), (1), (1), (1)
Applications (11), (4), (1)
Epitopes (4), (2), (1), (1), (1), (1)
Beacon