Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1) (N-Term) antibody

Details for Product No. ABIN502267
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2700038P16Rik, C80053, GatA, wu:fi03b10, 0929/02, CG6007, Dmel\\CG6007, bene, benedict, l(3)S092902
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Human
(8), (3), (3), (1), (1), (1), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (2)
Pubmed 1 reference available
Catalog no. ABIN502267
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human QRSL1
Sequence SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAF TCYAALGSDT
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against QRSL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name QRSL1
Background The function of the QRSL1 protein remains unknown.
Molecular Weight 57 kDa
Gene ID 55278
NCBI Accession NM_018292, NP_060762
UniProt Q9H0R6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 528 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glutaminyl-tRNA Synthase (Glutamine-Hydrolyzing)-Like 1 (QRSL1) (N-Term) antibody WB Suggested Anti-QRSL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Hosts (10)
Reactivities (8), (3), (3), (1), (1), (1), (1)
Applications (10), (2)
Epitopes (3), (2), (1), (1), (1)
back to top