TNF Receptor-Associated Factor 7 (TRAF7) (N-Term) antibody

Details for Product No. ABIN502378
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RFWD1, RNF119, RGD1559653, rfwd1, MGC52680, im:7149067, zgc:158391
Epitope
N-Term
(1), (1)
Reactivity
Rat (Rattus), Human
(21), (14), (14), (11), (11), (11), (11)
Host
Rabbit
(22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (7), (6), (2)
Pubmed 1 reference available
Catalog no. ABIN502378
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRAF7
Sequence GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEE DSMPPISTPR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rat : 100 %, Guinea pig : 90 %, Mouse : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against TRAF7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRAF7
Background Tumor necrosis factor (TNF, see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc
Molecular Weight 74 kDa
Gene ID 84231
NCBI Accession NM_032271, NP_115647
UniProt Q6Q0C0
Research Area Proteolysis / Ubiquitin, Innate Immunity, Cytokines, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 670 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Xu, Li, Shu: "TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17278-82, 2004 (PubMed).

Hosts (22)
Reactivities (21), (14), (14), (11), (11), (11), (11)
Applications (10), (9), (7), (6), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
back to top