Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502378

TNF Receptor-Associated Factor 7 (TRAF7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RFWD1, RNF119, RGD1559653, rfwd1, MGC52680, im:7149067, zgc:158391
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502378
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRAF7 antibody: synthetic peptide directed towards the N terminal of human TRAF7
Sequence GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEE DSMPPISTPR
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rat : 100%, Guinea pig : 92%, Mouse : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against TRAF7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRAF7
Background Tumor necrosis factor (TNF, see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc
Molecular Weight 74kDa
Gene ID 84231
NCBI Accession NP_115647, NM_032271
UniProt Q6Q0C0
Research Area Proteolysis / Ubiquitin, Innate Immunity, Cytokines, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRAF7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xu, Li, Shu: "TRAF7 potentiates MEKK3-induced AP1 and CHOP activation and induces apoptosis." in: The Journal of biological chemistry, Vol. 279, Issue 17, pp. 17278-82, 2004 (PubMed).

Alternatives for antigen "TNF Receptor-Associated Factor 7 (TRAF7)", type "Antibodies"
Hosts (22), (1)
Reactivities (22), (13), (13), (11), (11), (11), (11)
Applications (11), (9), (8), (5), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon