Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) (Middle Region) antibody

Details for Product No. ABIN502435
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gabt, Gat1, XT-1, GAT-1, Gabt1, Xtrp1, GABATR, GABATHG, A730043E01, si:ch211-280e18.1, si:dkey-164m14.1, slc6a1, GAT1
Epitope
Middle Region
(10), (8), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Human, Chicken
(19), (18), (12)
Host
Rabbit
(27), (1), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(28), (16), (7), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502435
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLC6A1
Sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGL AFLAYPEAVT
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against SLC6A1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC6A1
Background SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
Molecular Weight 67 kDa
Gene ID 6529
NCBI Accession NM_003042, NP_003033
UniProt P30531
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 599 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) (Middle Region) antibody WB Suggested Anti-SLC6A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver
anti-Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) (Middle Region) antibody (2) anti-Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) (Middle Region) antibody (Image 2)
Background publications Gotlib, Joormann, Minor et al.: "HPA axis reactivity: a mechanism underlying the associations among 5-HTTLPR, stress, and depression." in: Biological psychiatry, Vol. 63, Issue 9, pp. 847-51, 2008 (PubMed).

Hosts (27), (1), (1)
Reactivities (19), (18), (12)
Applications (28), (16), (7), (3), (1), (1), (1)
Epitopes (10), (8), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502435
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top