Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502435

Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gabt, Gat1, XT-1, GAT-1, Gabt1, Xtrp1, GABATR, GABATHG, A730043E01, si:ch211-280e18.1, si:dkey-164m14.1, slc6a1, GAT1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502435
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC6A1 antibody: synthetic peptide directed towards the middle region of human SLC6A1
Sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGL AFLAYPEAVT
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against SLC6A1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC6A1
Background SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
Molecular Weight 67kDa
Gene ID 6529
NCBI Accession NP_003033, NM_003042
UniProt P30531
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC6A1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gotlib, Joormann, Minor et al.: "HPA axis reactivity: a mechanism underlying the associations among 5-HTTLPR, stress, and depression." in: Biological psychiatry, Vol. 63, Issue 9, pp. 847-51, 2008 (PubMed).

Alternatives for antigen "Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1)", type "Antibodies"
Hosts (26), (1)
Reactivities (19), (17), (13)
Applications (26), (15), (7), (3), (2), (1)
Epitopes (9), (9), (2), (1), (1)
Beacon