Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 43, Member 1 (SLC43A1) (Middle Region) antibody

Details for Product No. ABIN502440
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610016F07Rik, AA986141, Lat3, PB39, Pov1, R00504, LAT3, POV1
Epitope
Middle Region
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(5), (2), (2)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502440
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SLC43A1
Sequence AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQ LLCLLTCPLI
Predicted Reactivity Mouse : 78 %
Characteristics This is a rabbit polyclonal antibody against SLC43A1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC43A1
Background SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).
Molecular Weight 61 kDa
Gene ID 8501
NCBI Accession NM_003627, NP_003618
UniProt O75387
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 559 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Babu, Kanai, Chairoungdua et al.: "Identification of a novel system L amino acid transporter structurally distinct from heterodimeric amino acid transporters." in: The Journal of biological chemistry, Vol. 278, Issue 44, pp. 43838-45, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502440
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top