Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502472

Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms VGAT, Viaat, R75019, BGT1, Gat1, RNU28927, Vgat, VIAAT, CG8394, CG8394.2, Dmel\\CG8394, vGAT, Ci-vGAT, slc32a1, viaat, MGC68938, vgat, xVIAAT
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502472
Quantity 50 µg
Price
317.90 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) (N-Term) antibody

Product details

Target Details Application Details Handling Images References Alternatives back to top
Immunogen The immunogen for anti-SLC32A1 antibody: synthetic peptide directed towards the N terminal of human SLC32A1
Sequence GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGG HDKPKITAWE
Predicted Reactivity 156718
Characteristics This is a rabbit polyclonal antibody against SLC32A1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified

Target Details

Application Details Handling Images References Alternatives back to top
Alternative Name SLC32A1
Background SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.The protein encoded by this gene is an integral membrane protein involved in gamma-aminobutyric acid (GABA) and glycine uptake into synaptic vesicles. The encoded protein is a member of amino acid/polyamine transporter family II.
Molecular Weight 57kDa
Gene ID 140679
NCBI Accession NP_542119, NM_080552
UniProt Q9H598
Research Area Neurology

Application Details

Target Details Handling Images References Alternatives back to top
Restrictions For Research Use only

Handling

Target Details Application Details Images References Alternatives back to top
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC32A1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C

References

Target Details Application Details Handling Images Alternatives back to top
Background publications Hashimoto, Arion, Unger et al.: "Alterations in GABA-related transcriptome in the dorsolateral prefrontal cortex of subjects with schizophrenia." in: Molecular psychiatry, Vol. 13, Issue 2, pp. 147-61, 2008 (PubMed).

Alternatives

Target Details Application Details Handling Images References back to top
Alternatives for antigen "Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1)", type "Antibodies"
Hosts (40)
Reactivities (26), (24), (16), (14), (14), (12), (12), (1)
Applications (28), (10), (8), (8), (5), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (5), (1)
Beacon