Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) (N-Term) antibody

Details for Product No. ABIN502472
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms VGAT, Viaat, R75019, BGT1, Gat1, RNU28927, Vgat, VIAAT, CG8394, CG8394.2, Dmel\\CG8394, vGAT, Ci-vGAT, slc32a1, viaat, MGC68938, vgat, xVIAAT
Epitope
N-Term
(8), (7), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(31), (28), (17), (16), (14), (12), (12), (1)
Host
Rabbit
(43), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (10), (9), (8), (6), (4), (3), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502472
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SLC32A1
Sequence GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGG HDKPKITAWE
Predicted Reactivity Bovine : 92 %, Dog : 92 %, Mouse : 92 %
Characteristics This is a rabbit polyclonal antibody against SLC32A1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC32A1
Background SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.The protein encoded by this gene is an integral membrane protein involved in gamma-aminobutyric acid (GABA) and glycine uptake into synaptic vesicles. The encoded protein is a member of amino acid/polyamine transporter family II.
Molecular Weight 57 kDa
Gene ID 140679
NCBI Accession NM_080552, NP_542119
UniProt Q9H598
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 525 AA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1) (N-Term) antibody WB Suggested Anti-SLC32A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate
Background publications Hashimoto, Arion, Unger et al.: "Alterations in GABA-related transcriptome in the dorsolateral prefrontal cortex of subjects with schizophrenia." in: Molecular psychiatry, Vol. 13, Issue 2, pp. 147-61, 2008 (PubMed).

Hosts (43), (1)
Reactivities (31), (28), (17), (16), (14), (12), (12), (1)
Applications (28), (10), (9), (8), (6), (4), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (1), (1)
back to top