Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502512

DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DJ10, Dj10, mDj10, dnajb12, wu:fc16f06, wu:fi38b10, MGC82876, DNAJB12
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Product details

Target Details Application Details Handling References Alternatives back to top
Immunogen The immunogen for anti-DNAJB12 antibody: synthetic peptide directed towards the middle region of human DNAJB12
Sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLG VVYYVGDTFS
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rat : 100%, African clawed frog : 92%, Chicken : 92%, Pig : 92%, Rabbit : 92%, Goat : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against DNAJB12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified

Target Details

Application Details Handling References Alternatives back to top
Alternative Name DNAJB12
Background DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the
Molecular Weight 42kDa
Gene ID 54788
NCBI Accession NP_001002762, NM_001002762
UniProt Q9NXW2

Application Details

Target Details Handling References Alternatives back to top
Restrictions For Research Use only

Handling

Target Details Application Details References Alternatives back to top
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DNAJB12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C

References

Target Details Application Details Handling Alternatives back to top
Background publications Ohtsuka, Hata: "Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature." in: Cell stress & chaperones, Vol. 5, Issue 2, pp. 98-112, 2001 (PubMed).

Alternatives

Target Details Application Details Handling References back to top
Alternatives for antigen "DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12)", type "Antibodies"
Hosts (11), (1)
Reactivities (7), (6), (2)
Applications (12), (4), (1)
Epitopes (6), (1), (1), (1), (1)
Beacon