DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (Middle Region) antibody

Details for Product No. ABIN502512
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DJ10, Dj10, mDj10, dnajb12, wu:fc16f06, wu:fi38b10, MGC82876, DNAJB12
Epitope
Middle Region
(6), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(9), (7), (3)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN502512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DNAJB12
Sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLG VVYYVGDTFS
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Chicken : 90 %, Pig : 90 %, Rabbit : 90 %, Goat : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DNAJB12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DNAJB12
Background DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the
Molecular Weight 42 kDa
Gene ID 54788
NCBI Accession NM_001002762, NP_001002762
UniProt Q9NXW2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 375 AA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ohtsuka, Hata: "Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature." in: Cell stress & chaperones, Vol. 5, Issue 2, pp. 98-112, 2001 (PubMed).

Hosts (13), (1)
Reactivities (9), (7), (3)
Applications (14), (3), (1)
Epitopes (6), (2), (1), (1), (1)
back to top