Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502559

Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A830037K02, A830073K23Rik, Sc5dl, ERG3, S5DES, SC5DL
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502559
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SC5DL antibody: synthetic peptide directed towards the N terminal of human SC5DL
Sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG EFPYGLFELV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SC5DL. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SC5DL
Background SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
Molecular Weight 35kDa
Gene ID 6309
NCBI Accession NP_001020127, NM_001024956
UniProt O75845
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SC5DL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Krakowiak, Wassif, Kratz et al.: "Lathosterolosis: an inborn error of human and murine cholesterol synthesis due to lathosterol 5-desaturase deficiency." in: Human molecular genetics, Vol. 12, Issue 13, pp. 1631-41, 2003 (PubMed).

Alternatives for antigen "Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon