Did you know that you can buy products from over 140 different suppliers from us?

Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL) (N-Term) antibody

Details for Product No. ABIN502559
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms A830037K02, A830073K23Rik, Sc5dl, ERG3, S5DES, SC5DL
Epitope
N-Term
(1)
Reactivity
Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502559
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SC5DL
Sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG EFPYGLFELV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SC5DL. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SC5DL
Background SC5DL catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol.This gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
Molecular Weight 35 kDa
Gene ID 6309
NCBI Accession NM_001024956, NP_001020127
UniProt O75845
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 299 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sterol-C5-Desaturase (ERG3 delta-5-Desaturase Homolog, S. Cerevisiae)-Like (SC5DL) (N-Term) antibody WB Suggested Anti-SC5DL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate
Background publications Krakowiak, Wassif, Kratz et al.: "Lathosterolosis: an inborn error of human and murine cholesterol synthesis due to lathosterol 5-desaturase deficiency." in: Human molecular genetics, Vol. 12, Issue 13, pp. 1631-41, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502559
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top