Oxysterol Binding Protein-Like 3 (OSBPL3) (N-Term) antibody

Details for Product No. ABIN502661
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ORP-3, ORP3, OSBP3, RGD1564287, 1200014M06Rik, 6720421I08Rik, A530055M08, osbpl3, zgc:101089, OSBPL3
Epitope
N-Term
(3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(9), (4), (4), (1), (1), (1)
Host
Rabbit
(7), (4), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (5), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502661
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human OSBPL3
Sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEG LRGEMNYTQE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against OSBPL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name OSBPL3
Background The specific functin of this protein remains unknown.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.
Molecular Weight 98 kDa
Gene ID 26031
NCBI Accession NM_145320, NP_663160
UniProt A4D169
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 856 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (7), (4), (1)
Reactivities (9), (4), (4), (1), (1), (1)
Applications (8), (5), (1), (1)
Epitopes (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top