Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502661

Oxysterol Binding Protein-Like 3 (OSBPL3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ORP-3, ORP3, OSBP3, RGD1564287, 1200014M06Rik, 6720421I08Rik, A530055M08, osbpl3, zgc:101089, OSBPL3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502661
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OSBPL3 antibody: synthetic peptide directed towards the N terminal of human OSBPL3
Sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEG LRGEMNYTQE
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against OSBPL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OSBPL3
Background The specific functin of this protein remains unknown.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.
Molecular Weight 98kDa
Gene ID 26031
NCBI Accession NP_663160, NM_145320
UniProt A4D169
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OSBPL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Oxysterol Binding Protein-Like 3 (OSBPL3)", type "Antibodies"
Hosts (6), (5), (1)
Reactivities (9), (4), (4), (2), (2), (2)
Applications (8), (6), (1), (1)
Epitopes (3), (1)
Beacon