Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502689

Parvin, beta (PARVB) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CGI-56, AI595373, AW742462, D15Gsk1, affixin, fd02e01, zgc:73117, wu:fd02e01, beta-parvin
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502689
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARVB antibody: synthetic peptide directed towards the C terminal of human PARVB
Sequence HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNL FTKYKNVE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Pig : 93%, African clawed frog : 92%, Dog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PARVB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PARVB
Background Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.
Molecular Weight 45kDa
Gene ID 29780
NCBI Accession NP_001003828, NM_001003828
UniProt Q96PN1
Research Area Signaling, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARVB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Johnstone, Mongroo, Rich et al.: "Parvin-beta inhibits breast cancer tumorigenicity and promotes CDK9-mediated peroxisome proliferator-activated receptor gamma 1 phosphorylation." in: Molecular and cellular biology, Vol. 28, Issue 2, pp. 687-704, 2008 (PubMed).

Alternatives for antigen "Parvin, beta (PARVB)", type "Antibodies"
Hosts (7), (4)
Reactivities (9), (3), (3), (1), (1), (1), (1), (1)
Applications (11), (6), (2)
Epitopes (2), (1), (1)
Beacon