Did you know that you can buy products from over 140 different suppliers from us?

Parvin, beta (PARVB) (C-Term) antibody

Details for Product No. ABIN502689
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CGI-56, AI595373, AW742462, D15Gsk1, affixin, fd02e01, zgc:73117, wu:fd02e01, beta-parvin
Epitope
C-Term
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(9), (3), (3), (1), (1), (1), (1), (1)
Host
Rabbit
(7), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502689
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PARVB
Sequence HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNL FTKYKNVE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Pig : 90 %, African clawed frog : 90 %, Dog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PARVB. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PARVB
Background Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.
Molecular Weight 45 kDa
Gene ID 29780
NCBI Accession NM_001003828, NP_001003828
UniProt Q96PN1
Research Area Signaling, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 397 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Johnstone, Mongroo, Rich et al.: "Parvin-beta inhibits breast cancer tumorigenicity and promotes CDK9-mediated peroxisome proliferator-activated receptor gamma 1 phosphorylation." in: Molecular and cellular biology, Vol. 28, Issue 2, pp. 687-704, 2008 (PubMed).

Hosts (7), (4)
Reactivities (9), (3), (3), (1), (1), (1), (1), (1)
Applications (11), (3), (2)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502689
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top