Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502697

Heat Shock 70kDa Protein 4 (HSPA4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms APG-2, HS24/P52, HSPH2, RY, hsp70, hsp70RY, 70kDa, AI317151, Hsp110, Hsp70RY, mKIAA4025, hspa4, wu:fi30e11, zgc:55743, zgc:77413, hs24/p52, hspa4-a, osp94, pg-2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4
Sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQY DHLDAADMTK
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, African clawed frog : 85%, Chicken : 85%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against HSPA4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HSPA4
Background HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.
Molecular Weight 94kDa
Gene ID 3308
NCBI Accession NP_002145, NM_002154
UniProt P34932
Research Area Heat Shock Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HSPA4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).

Alternatives for antigen "Heat Shock 70kDa Protein 4 (HSPA4)", type "Antibodies"
Hosts (12), (9)
Reactivities (12), (3), (2), (1), (1), (1), (1), (1)
Applications (20), (6), (5), (4), (3), (2), (2), (2), (2), (1)
Epitopes (2), (2), (2), (1)
Beacon