Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502847

Zinc Finger Protein 37A (ZNF37A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX21, ZNF37, ZNF37A
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Fruit Fly (Drosophila melanogaster), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502847
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the C terminal of human ZNF37A
Sequence LIKHQRIHTGEKPYECNECGKSFSEKSTLTKHLRTHTGEK PYECIQCGKF
Predicted Reactivity Rat :100%,   Florida lancelet :100%,   African clawed frog :100%,   Mouse :100%,   Sumatran orangutan :100%,   White-throated sparrow :92%,   Dog :92%,   Crab-eating macaque :92%,   Human :100%,   Chicken :92%,   Savannah tsetse fly :92%,   Atlantic salmon :92%,   Fruit fly :92%,   Bornean orangutan :92%,   Western Gorilla :92%,   Bovine :92%,   Caenorhabditis elegans :91%,   Common woolly monkey :85%,   Slender loris :85%,   Red flour beetle :85%,   Black-legged tick :85%,   Starlet sea anemone :85%,   Chimpanzee :85%,   Red-chested mustached tamarin :85%,   Rhesus macaque :85%,   Ring-tailed lemur :85%,   Pig-tailed macaque :85%,   Leopard gecko :84%,   Natrix domestica :84%,   Southern platyfish :84%,  
Characteristics This is a rabbit polyclonal antibody against ZNF37A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF37A
Background ZNF37A belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 65kDa
Gene ID 7587
NCBI Accession NP_001007095, NM_001007094
UniProt P17032
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF37A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 37A (ZNF37A)", type "Antibodies"
Hosts (13), (9)
Reactivities (23), (2), (2), (2), (2), (2)
Applications (17), (5), (2), (2), (1)
Epitopes (4), (3), (3), (3), (3), (2), (1)
Beacon