SCAN Domain Containing 3 (SCAND3) (C-Term) antibody

Details for Product No. ABIN502887
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Buster4, ZBED9, ZFP38-L, ZNF305P2, ZNF452, dJ1186N24.3
Epitope
C-Term
(4), (1)
Reactivity
Human
(7), (2), (2), (1), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 1 reference available
Catalog no. ABIN502887
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SCAND3
Sequence ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTS KKQAHLSH
Predicted Reactivity Horse : 100 %
Characteristics This is a rabbit polyclonal antibody against SCAND3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SCAND3
Background The function of SCAND3 has not yet been determined.
Molecular Weight 152 kDa
Gene ID 114821
NCBI Accession NM_052923, NP_443155
UniProt Q6R2W3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1325 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SCAN Domain Containing 3 (SCAND3) (C-Term) antibody WB Suggested Anti-SCAND3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (8)
Reactivities (7), (2), (2), (1), (1)
Applications (7)
Epitopes (4), (1)
back to top