Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502887

SCAN Domain Containing 3 (SCAND3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Buster4, ZBED9, ZFP38-L, ZNF305P2, ZNF452, dJ1186N24.3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502887
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SCAND3 antibody: synthetic peptide directed towards the C terminal of human SCAND3
Sequence ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTS KKQAHLSH
Predicted Reactivity Horse : 100%
Characteristics This is a rabbit polyclonal antibody against SCAND3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SCAND3
Background The function of SCAND3 has not yet been determined.
Molecular Weight 152kDa
Gene ID 114821
NCBI Accession NP_443155, NM_052923
UniProt Q6R2W3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SCAND3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "SCAN Domain Containing 3 (SCAND3)", type "Antibodies"
Hosts (8)
Reactivities (7), (2), (2), (1), (1)
Applications (7), (2)
Epitopes (4), (1)
Beacon