Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502921

Lipase, Gastric (LIPF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GL, HGL, HLAL, Rnlp, RNLIP, AV082900, 2310051B21Rik, DGL, fb73g06, zgc:56632, wu:fb73g06, LIPF
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502921
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LIPF antibody: synthetic peptide directed towards the N terminal of human LIPF
Sequence ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNT GQRPVVFLQH
Predicted Reactivity Human : 100%, Rabbit : 92%, Guinea pig : 90%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against LIPF. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LIPF
Background The specific functin of this protein remains unknown.This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.
Molecular Weight 43kDa
Gene ID 8513
NCBI Accession NP_004181, NM_004190
UniProt P07098
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LIPF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Lipase, Gastric (LIPF)", type "Antibodies"
Hosts (11), (5), (3)
Reactivities (14), (6), (1), (1), (1)
Applications (15), (11), (4), (4), (4)
Conjugates (2), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (1)
Beacon