Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502996

N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NARG1L, Narg1l, 1300019C06Rik, narg1, narg1l, ga19, nath, tbdn100, MGC135844
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502996
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L
Sequence RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHS NLPDIVSKVL
Predicted Reactivity Bovine :100%,   Mouse :100%,   Crab-eating macaque :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against NARG1L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NARG1L
Background NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.
Molecular Weight 101kDa
Gene ID 79612
NCBI Accession NP_078837, NM_024561
UniProt Q6N069
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NARG1L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives for antigen "N(alpha)-Acetyltransferase 16, NatA Auxiliary Subunit (NAA16)", type "Antibodies"
Hosts (8)
Reactivities (5), (3), (3), (2)
Applications (8), (3), (3), (1)
Epitopes (2), (1), (1)
Beacon