Did you know that you can buy products from over 140 different suppliers from us?

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (N-Term) antibody

Details for Product No. ABIN502998
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MTH3, BC036718, RGD1311802, zgc:110174
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(16), (1), (1)
Host
Rabbit
(12), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (6), (4), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502998
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NUDT18
Sequence MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRK NVCYVVLAVF
Predicted Reactivity Dog : 100 %, Bovine : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against NUDT18. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NUDT18
Background NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Molecular Weight 35 kDa
Gene ID 79873
NCBI Accession NM_024815, NP_079091
UniProt Q6ZVK8
Research Area Signaling, Metabolism, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 323 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (N-Term) antibody WB Suggested Anti-NUDT18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Validation Images
back to top