Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502998

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC036718, RGD1311802, MTH3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502998
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the N terminal of human NUDT18
Sequence MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRK NVCYVVLAVF
Predicted Reactivity Dog : 100%, Bovine : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against NUDT18. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NUDT18
Background NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Molecular Weight 35kDa
Gene ID 79873
NCBI Accession NP_079091, NM_024815
UniProt Q6ZVK8
Research Area Signaling, Metabolism, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDT18 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18)", type "Antibodies"
Hosts (12), (6)
Reactivities (15), (1), (1)
Applications (17), (6), (4), (3), (3), (2), (1), (1)
Epitopes (2), (1), (1)
Beacon