Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503016

beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B3GalNAc-T2, MDDGA11, RGD1306946, zgc:112351, A930105D20Rik, C80633, D230016N13Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503016
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-B3GALNT2 antibody: synthetic peptide directed towards the middle region of human B3GALNT2
Sequence GKWQELEYPSPAYPAFACGSGYVISKDIVKWLASNSGRLK TYQGEDVSMG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against B3GALNT2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name B3GALNT2
Background B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
Molecular Weight 57kDa
Gene ID 148789
NCBI Accession NP_689703, NM_152490
UniProt Q8NCR0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-B3GALNT2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2)", type "Antibodies"
Hosts (9), (1)
Reactivities (7), (3), (3), (2), (1)
Applications (9), (3)
Epitopes (2), (1), (1)
Beacon