Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503035

DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms JPDI, ERdj5, D2Ertd706e, 1200006L06Rik, MTHr, PDIA19, DNAJC10, dnajc10, zgc:162218
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503035
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DNAJC10 antibody: synthetic peptide directed towards the N terminal of human DNAJC10
Sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAH GDFLKINRAY
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Chicken : 92%, Guinea pig : 92%, Horse : 92%, Zebrafish : 83%
Characteristics This is a rabbit polyclonal antibody against DNAJC10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DNAJC10
Background This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
Molecular Weight 91kDa
Gene ID 54431
NCBI Accession NP_061854, NM_018981
UniProt Q8IXB1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DNAJC10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10)", type "Antibodies"
Hosts (21), (8)
Reactivities (26), (22), (19), (12), (12), (12)
Applications (16), (15), (10), (5), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (2), (1)
Beacon