Did you know that you can buy products from over 140 different suppliers from us?

DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) (N-Term) antibody

Details for Product No. ABIN503035
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DNAJC10, dnajc10, zgc:162218, ERdj5, JPDI, MTHr, PDIA19, 1200006L06Rik, D2Ertd706e
Epitope
N-Term
(10), (7), (5), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(28), (28), (20), (12), (12), (12)
Host
Rabbit
(28), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (15), (10), (4), (4), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503035
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DNAJC10
Sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAH GDFLKINRAY
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 90 %, Guinea pig : 90 %, Horse : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DNAJC10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DNAJC10
Background This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
Molecular Weight 91 kDa
Gene ID 54431
NCBI Accession NM_018981, NP_061854
UniProt Q8IXB1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 793 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) (N-Term) antibody WB Suggested Anti-DNAJC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: ACHN cell lysate
anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) (N-Term) antibody (2) WB Suggested Anti-DNAJC10
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.500
Positive Control: ACHN cell lysate
DNAJC10 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Validation Images
back to top