Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503160

RB1-Inducible Coiled-Coil 1 (RB1CC1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CC1, FIP200, 2900055E04Rik, 5930404L04Rik, Cc1, LaXp180, DKFZp459E2330
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503160
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RB1CC1 antibody: synthetic peptide directed towards the C terminal of human RB1CC1
Sequence SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVK AVSWNKKV
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RB1CC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RB1CC1
Background RB1CC1 is implicated in the regulation of RB1 expression. It functions as a DNA-binding transcription factor. RB1CC1 is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. The expression of RB1CC1 is, thus, a prerequisite for myogenic differentiation. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene.
Molecular Weight 183kDa
Gene ID 9821
NCBI Accession NP_001077086, NM_001083617
UniProt Q8TDY2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RB1CC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hara, Takamura, Kishi et al.: "FIP200, a ULK-interacting protein, is required for autophagosome formation in mammalian cells." in: The Journal of cell biology, Vol. 181, Issue 3, pp. 497-510, 2008 (PubMed).

Alternatives for antigen "RB1-Inducible Coiled-Coil 1 (RB1CC1)", type "Antibodies"
Hosts (30), (2)
Reactivities (25), (22), (11), (11), (11), (11), (11)
Applications (23), (13), (9), (5), (4), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1)
Beacon