Did you know that you can buy products from over 140 different suppliers from us?

Trafficking Protein Particle Complex 2 (TRAPPC2) (Middle Region) antibody

Details for Product No. ABIN503168
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MIP2A, SEDL, SEDT, TRAPPC2P1, TRS20, ZNF547L, hYP38334, 1110066L09Rik, 1810064C02Rik, AW496358, MIP-2A, Sedl, RGD1306925
Epitope
Middle Region
(11), (8), (6), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(27), (5), (3)
Host
Rabbit
(19), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(27), (17), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503168
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRAPPC2
Sequence RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRK VQFLGKKHLL
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against TRAPPC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRAPPC2
Background TRAPPC2 prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. TRAPPC2 may play a role in vesicular transport from endoplasmic reticulum to Golgi.The protein encoded by this gene is thought to be part of a large multisubunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind MBP1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseuodogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been found for this gene.
Molecular Weight 16 kDa
Gene ID 6399
NCBI Accession NM_014563, NP_055378
UniProt O14582
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 140 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Trafficking Protein Particle Complex 2 (TRAPPC2) (Middle Region) antibody WB Suggested Anti-TRAPPC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Spleen
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503168
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top