Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503168

Trafficking Protein Particle Complex 2 (TRAPPC2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MIP2A, SEDL, SEDT, TRAPPC2P1, TRS20, ZNF547L, hYP38334, 1110066L09Rik, 1810064C02Rik, AW496358, MIP-2A, Sedl, RGD1306925
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503168
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRAPPC2 antibody: synthetic peptide directed towards the middle region of human TRAPPC2
Sequence RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRK VQFLGKKHLL
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against TRAPPC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRAPPC2
Background TRAPPC2 prevents MBP1-mediated transcriptional repression and antagonizes MBP1-mediated cell death. TRAPPC2 may play a role in vesicular transport from endoplasmic reticulum to Golgi.The protein encoded by this gene is thought to be part of a large multisubunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind MBP1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseuodogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been found for this gene.
Molecular Weight 16kDa
Gene ID 6399
NCBI Accession NP_055378, NM_014563
UniProt O14582
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRAPPC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Trafficking Protein Particle Complex 2 (TRAPPC2)", type "Antibodies"
Hosts (12), (3)
Reactivities (14), (4), (2)
Applications (14), (6), (1)
Epitopes (6), (2), (2), (2), (1)
Beacon