Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503229

DDB1 and CUL4 Associated Factor 12 (DCAF12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT102, KIAA1892, TCC52, WDR40A, Wdr40a, AA420338, AI851081, 1500001L20Rik, 5830424K06Rik, wdr40a, wdr40b, wu:fb93d04, zgc:154031
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503229
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A
Sequence ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPP VKRSLVYYLK
Predicted Reactivity Human :100%,   Dog :92%,   Crab-eating macaque :92%,   Bovine :91%,   Mouse :85%,  
Characteristics This is a rabbit polyclonal antibody against WDR40A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDR40A
Background The function of WDR40A has not yet been determined.This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.
Molecular Weight 50kDa
Gene ID 25853
NCBI Accession NP_056212, NM_015397
UniProt Q5T6F0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDR40A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives for antigen "DDB1 and CUL4 Associated Factor 12 (DCAF12)", type "Antibodies"
Hosts (21), (9)
Reactivities (28), (19), (19), (13), (13), (13), (12), (1)
Applications (21), (15), (10), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (2), (2), (2), (1), (1)
Beacon