Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503386

DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Di-Ras1, GBTS1, RIG, Gbts1, diras1, fi18d11, zgc:55360, wu:fi18d11, arhi, di-ras1, di-ras3, gbts1, noey2, rig, si:dkey-97k23.2, MGC146486
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503386
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the middle region of human DIRAS1
Sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRS GKQKRTDRVK
Predicted Reactivity Bovine : 92%, Zebrafish : 92%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against DIRAS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DIRAS1
Background DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases. DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS, MIM 190020) superfamily of monomeric GTPases.
Molecular Weight 22kDa
Gene ID 148252
NCBI Accession NP_660156, NM_145173
UniProt O95057
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DIRAS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1)", type "Antibodies"
Hosts (27), (4), (2)
Reactivities (30), (15), (15), (12), (12), (12), (12), (1), (1)
Applications (21), (11), (10), (7), (5), (4), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon