Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503419

Intermediate Filament Tail Domain Containing 1 (IFLTD1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAS1C1, RGD1560077, 4933403M22Rik, AI482300, Lmna-rs1, Lmna1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503419
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IFLTD1 antibody: synthetic peptide directed towards the middle region of human IFLTD1
Sequence PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDR QPRSRSTRPN
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against IFLTD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IFLTD1
Background The specific function of this protein remains unknown.
Molecular Weight 43kDa
Gene ID 160492
NCBI Accession NP_689803, NM_152590
UniProt Q8N9Z9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IFLTD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wang, Futamura, Wang et al.: "Pas1c1 is a candidate for the mouse pulmonary adenoma susceptibility 1 locus." in: Oncogene, Vol. 24, Issue 11, pp. 1958-63, 2005 (PubMed).

Alternatives for antigen "Intermediate Filament Tail Domain Containing 1 (IFLTD1)", type "Antibodies"
Hosts (4)
Reactivities (3), (2), (2)
Applications (4), (2), (2)
Epitopes (2), (1)
Beacon