Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503489

Tubulin, Alpha, 3C (TUBA3C) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TUBA3D, TUBA2, bA408E5.3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Arabidopsis, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503489
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TUBA3C antibody: synthetic peptide directed towards the N terminal of human TUBA3C
Sequence QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTV VDEVRTGTYR
Predicted Reactivity African clawed frog : 100%
Characteristics This is a rabbit polyclonal antibody against TUBA3C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TUBA3C
Background Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene is an alpha tubulin gene that encodes a protein 99% identical to the mouse testis-specific Tuba3 and Tuba7 gene products. This gene is located in the 13q11 region, which is associated with the genetic diseases Clouston hidrotic ectodermal dysplasia and Kabuki syndrome.
Molecular Weight 50kDa
Gene ID 7278
NCBI Accession NP_005992, NM_006001
UniProt Q13748
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TUBA3°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Alternatives for antigen "Tubulin, Alpha, 3C (TUBA3C)", type "Antibodies"
Hosts (9), (5)
Reactivities (14), (5), (5), (1), (1)
Applications (14), (9), (4), (4)
Epitopes (6), (3), (2), (2), (1), (1)
Beacon