Did you know that you can buy products from over 140 different suppliers from us?

LIM and SH3 Protein 1 (LASP1) (C-Term) antibody

Details for Product No. ABIN503571
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MLN50, Lasp-1, Def-4, SH3P6, AA408629, Tg(Col1a1-lacZ)1Ngma, fb92f05, zgc:77542, wu:fb92f05, LASP1, DKFZp459O1227, lasp1, MGC53336, MGC89667, mln50, lasp-1
Epitope
C-Term
(13), (8), (6), (6), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(45), (7), (7), (6), (4), (1), (1), (1), (1), (1)
Host
Rabbit
(25), (15), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(47), (27), (7), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503571
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human LASP1
Sequence SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEV SFQDGDTIVN
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Rabbit : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against LASP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LASP1
Background LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.This gene encodes a member of a LIM protein subfamily which is characterized by a LIM motif and a domain of Src homology region 3. This protein functions as an actin-binding protein and possibly in cytoskeletal organization.
Molecular Weight 30 kDa
Gene ID 3927
NCBI Accession NM_006148, NP_006139
UniProt Q14847
Research Area Signaling, Cytoskeleton, Microfilaments
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 261 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-LIM and SH3 Protein 1 (LASP1) (C-Term) antibody WB Suggested Anti-LASP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Product cited in: Stone, Merriman, Cantor et al.: "High density SNP association study of a major autism linkage region on chromosome 17." in: Human molecular genetics, Vol. 16, Issue 6, pp. 704-15, 2007 (PubMed).

Hosts (25), (15), (10)
Reactivities (45), (7), (7), (6), (4), (1), (1), (1), (1), (1)
Applications (47), (27), (7), (3), (2), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (13), (8), (6), (6), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503571
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top