Did you know that you can buy products from over 140 different suppliers from us?

Mitochondrial Carrier 2 (MTCH2) (N-Term) antibody

Details for Product No. ABIN503634
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MIMP, SLC25A50, Hspc032, fi20c06, fj35g12, wu:fi20c06, wu:fj35g12, 2310034D24Rik, 4930539J07Rik, HSPC032
Epitope
N-Term
(20), (7), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(35), (22), (14), (12), (1), (1), (1)
Host
Rabbit
(37)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (18), (17), (9), (7)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503634
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MTCH2
Sequence TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPR LCSGVLGTVV
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Bovine : 90 %, Pig : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against MTCH2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MTCH2
Background MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
Molecular Weight 33 kDa
Gene ID 23788
NCBI Accession NM_014342, NP_055157
UniProt Q9Y6C9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 303 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitochondrial Carrier 2 (MTCH2) (N-Term) antibody WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Grinberg, Schwarz, Zaltsman et al.: "Mitochondrial carrier homolog 2 is a target of tBID in cells signaled to die by tumor necrosis factor alpha." in: Molecular and cellular biology, Vol. 25, Issue 11, pp. 4579-90, 2005 (PubMed).

Validation Images
back to top