Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503664

Smg-5 Homolog, Nonsense Mediated MRNA Decay Factor (C. Elegans) (SMG5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EST1B, LPTS-RP1, LPTSRP1, SMG-5, BC024683, mKIAA1089, zgc:113841
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503664
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMG5 antibody: synthetic peptide directed towards the N terminal of human SMG5
Sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCN KTAYQEVFKP
Predicted Reactivity Bovine : 100%, Human : 100%, Horse : 92%, Mouse : 92%, Pig : 92%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against SMG5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SMG5
Background SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).
Molecular Weight 114kDa
Gene ID 23381
NCBI Accession NP_056142, NM_015327
UniProt Q9UPR3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMG5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Glavan, Behm-Ansmant, Izaurralde et al.: "Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex." in: The EMBO journal, Vol. 25, Issue 21, pp. 5117-25, 2006 (PubMed).

Alternatives for antigen "Smg-5 Homolog, Nonsense Mediated MRNA Decay Factor (C. Elegans) (SMG5)", type "Antibodies"
Hosts (6), (1)
Reactivities (6), (2), (2)
Applications (7), (2), (2), (1)
Epitopes (2), (2), (1), (1)
Beacon