Did you know that you can buy products from over 140 different suppliers from us?

Smg-5 Homolog, Nonsense Mediated MRNA Decay Factor (C. Elegans) (SMG5) (N-Term) antibody

Details for Product No. ABIN503664
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EST1B, LPTS-RP1, LPTSRP1, SMG-5, BC024683, mKIAA1089, zgc:113841
Epitope
N-Term
(7), (6), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(13), (2), (2)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (8), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503664
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMG5
Sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCN KTAYQEVFKP
Predicted Reactivity Bovine : 100 %, Human : 100 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against SMG5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SMG5
Background SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).
Molecular Weight 114 kDa
Gene ID 23381
NCBI Accession NM_015327, NP_056142
UniProt Q9UPR3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1016 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Smg-5 Homolog, Nonsense Mediated MRNA Decay Factor (C. Elegans) (SMG5) (N-Term) antibody WB Suggested Anti-SMG5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Glavan, Behm-Ansmant, Izaurralde et al.: "Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex." in: The EMBO journal, Vol. 25, Issue 21, pp. 5117-25, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503664
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top