Family with Sequence Similarity 175, Member B (FAM175B) (Middle Region) antibody

Details for Product No. ABIN503696
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ABRO1, KIAA0157, Abro1, AA589499, AI853413, C430003P19Rik, RGD1308918, abro1, MGC83343
Epitope
Middle Region
(2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(7), (1), (1), (1)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN503696
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KIAA0157
Sequence FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMER SVFMPRPQAV
Predicted Reactivity Rat :100 %,   Dog :100 %,   Mouse :100 %,   Human :100 %,   Bovine :90 %,  
Characteristics This is a rabbit polyclonal antibody against KIAA0157. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA0157
Background KIAA0157 is the component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.
Molecular Weight 47 kDa
Gene ID 23172
NCBI Accession NM_032182, NP_115558
UniProt Q15018
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 415 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 175, Member B (FAM175B) (Middle Region) antibody WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (7), (2)
Reactivities (7), (1), (1), (1)
Applications (8), (2), (2), (2)
Epitopes (2), (2), (1), (1), (1)
back to top