Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503696

Family with Sequence Similarity 175, Member B (FAM175B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ABRO1, KIAA0157, Abro1, AA589499, AI853413, C430003P19Rik, RGD1308918, abro1, MGC83343
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503696
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIAA0157 antibody: synthetic peptide directed towards the middle region of human KIAA0157
Sequence FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMER SVFMPRPQAV
Predicted Reactivity Rat :100%,   Dog :100%,   Mouse :100%,   Human :100%,   Bovine :92%,  
Characteristics This is a rabbit polyclonal antibody against KIAA0157. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIAA0157
Background KIAA0157 is the component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.
Molecular Weight 47kDa
Gene ID 23172
NCBI Accession NP_115558, NM_032182
UniProt Q15018
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIAA0157 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 175, Member B (FAM175B)", type "Antibodies"
Hosts (10), (2)
Reactivities (10), (1), (1), (1)
Applications (10), (4), (2), (2), (2)
Epitopes (2), (2), (2), (1), (1)
Beacon