Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503716

LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AV033872, AW538442, 2210402C18Rik, RGD1304585, zgc:91941, MGC108236
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503716
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LYSMD2 antibody: synthetic peptide directed towards the middle region of human LYSMD2
Sequence VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLK KTLNIPVISE
Predicted Reactivity Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against LYSMD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LYSMD2
Background The specific function of the protein remains unknown.
Molecular Weight 23kDa
Gene ID 256586
NCBI Accession NP_699205, NM_153374
UniProt Q8IV50
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LYSMD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2)", type "Antibodies"
Hosts (2), (1)
Reactivities (2), (1)
Applications (3), (1), (1)
Epitopes (1), (1)
Beacon