Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503724

Epoxide Hydrolase 4 (EPHX4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ABHD7, Abhd7, Ephxrp, Gm1382, EPHXRP
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503724
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABHD7 antibody: synthetic peptide directed towards the N terminal of human ABHD7
Sequence HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWR YQLREFKSEY
Predicted Reactivity Rat :100%,   Mouse :100%,   Chicken :100%,   Bovine :100%,   Human :100%,   Florida lancelet :92%,   Green puffer :92%,   Western clawed frog :78%,  
Characteristics This is a rabbit polyclonal antibody against ABHD7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABHD7
Background The specific function of ABHD7 is not yet known.
Molecular Weight 42kDa
Gene ID 253152
NCBI Accession NP_775838, NM_173567
UniProt Q8IUS5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABHD7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Epoxide Hydrolase 4 (EPHX4)", type "Antibodies"
Hosts (13)
Reactivities (12), (10), (1), (1), (1), (1), (1), (1)
Applications (13), (9), (1)
Epitopes (5), (1), (1)
Beacon