Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 98, Member B (FAM98B) (N-Term) antibody

Details for Product No. ABIN503726
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610510H03Rik, RGD1564603
Epitope
N-Term
(3)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(16), (12), (12), (12), (11), (11)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (9), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503726
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FAM98B
Sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGR DDLESFQLEI
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Bovine : 90 %, Guinea pig : 90 %, Pig : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against FAM98B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM98B
Background The specific function of FAM98B is not yet known.
Molecular Weight 45 kDa
Gene ID 283742
NCBI Accession NM_173611, NP_775882
UniProt A8MUW5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 98, Member B (FAM98B) (N-Term) antibody WB Suggested Anti-FAM98B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen
Background publications Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503726
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top