Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503751

Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4632401D06Rik, AW125451, im:6904481
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503751
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRRTM1 antibody: synthetic peptide directed towards the middle region of human LRRTM1
Sequence CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHL CEDGAEPTSG
Predicted Reactivity Dog : 100%, Horse : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against LRRTM1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRRTM1
Background LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.
Molecular Weight 59kDa
Gene ID 347730
NCBI Accession NP_849161, NM_178839
UniProt Q86UE6
Research Area Organogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRRTM1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Francks, Maegawa, Laurén et al.: "LRRTM1 on chromosome 2p12 is a maternally suppressed gene that is associated paternally with handedness and schizophrenia." in: Molecular psychiatry, Vol. 12, Issue 12, pp. 1129-39, 1057, 2007 (PubMed).

Alternatives for antigen "Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1)", type "Antibodies"
Hosts (37)
Reactivities (35), (30), (26), (18), (18), (18), (17), (1)
Applications (23), (15), (11), (10), (9), (5)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (2), (2), (2), (1)
Beacon