Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503810

LRRN4 C-terminal Like (LRRN4CL) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110067I12Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503810
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LRRN4CL antibody: synthetic peptide directed towards the middle region of human LOC221091
Sequence PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPG GIYVVCVVAA
Predicted Reactivity Horse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against LOC221091. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LRRN4CL
Background The function of this protein remains unknown.
Molecular Weight 25kDa
Gene ID 221091
NCBI Accession NP_981967, NM_203422
UniProt Q8ND94
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LRRN4CL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "LRRN4 C-terminal Like (LRRN4CL)", type "Antibodies"
Hosts (5), (2)
Reactivities (7)
Applications (7), (3), (2), (2), (2)
Epitopes (2), (2), (2), (2), (1), (1)
Beacon