Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503820

Zinc Finger, DHHC-Type Containing 24 (ZDHHC24) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5730496N17Rik, Leng4, zgc:91907, wu:fe02b01
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503820
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZDHHC24 antibody: synthetic peptide directed towards the middle region of human ZDHHC24
Sequence QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITF QTTADVGHTA
Predicted Reactivity Bovine : 91%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against ZDHHC24. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZDHHC24
Background The specific function of the protein remains unknown.
Molecular Weight 30kDa
Gene ID 254359
NCBI Accession NP_997223, NM_207340
UniProt Q6UX98
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZDHHC24 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Zinc Finger, DHHC-Type Containing 24 (ZDHHC24)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1), (1)
Applications (8), (3), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon