Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503841

Protein S (Alpha) (PROS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PROS, PS21, PS22, PS23, PS24, PS25, PSA, THPH5, THPH6, AW214361, zgc:154001
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503841
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1
Sequence MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLP LNLDTKYELL
Predicted Reactivity Horse : 100%, Human : 100%, Mouse : 100%, Guinea pig : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against PROS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PROS1
Background PROS1 is an anticoagulant plasma protein, it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
Molecular Weight 71kDa
Gene ID 5627
NCBI Accession NP_000304, NM_000313
UniProt P07225
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PROS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ten Kate, Platteel, Mulder et al.: "PROS1 analysis in 87 pedigrees with hereditary protein S deficiency demonstrates striking genotype-phenotype associations." in: Human mutation, Vol. 29, Issue 7, pp. 939-47, 2008 (PubMed).

Alternatives for antigen "Protein S (Alpha) (PROS1)", type "Antibodies"
Hosts (16), (10), (8), (6), (2)
Reactivities (40), (7), (7)
Applications (32), (20), (5), (4), (3), (2), (2), (2), (2), (1), (1)
Conjugates (3), (1)
Epitopes (3), (3), (2), (2), (1), (1), (1), (1)
Beacon