Did you know that you can buy products from over 140 different suppliers from us?

Protein S (Alpha) (PROS1) (Middle Region) antibody

Details for Product No. ABIN503841
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zgc:154001, PROS, PS21, PS22, PS23, PS24, PS25, PSA, THPH5, THPH6, AW214361
Epitope
Middle Region
(3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
(42), (9), (8)
Host
Rabbit
(20), (10), (8), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(33), (21), (6), (4), (3), (3), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503841
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PROS1
Sequence MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLP LNLDTKYELL
Predicted Reactivity Horse : 100 %, Human : 100 %, Mouse : 100 %, Guinea pig : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against PROS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PROS1
Background PROS1 is an anticoagulant plasma protein, it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.
Molecular Weight 71 kDa
Gene ID 5627
NCBI Accession NM_000313, NP_000304
UniProt P07225
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 676 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein S (Alpha) (PROS1) (Middle Region) antibody WB Suggested Anti-PROS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
anti-Protein S (Alpha) (PROS1) (Middle Region) antibody (2) Immunohistochemistry with Liver tissue at an antibody concentration of 5µg/ml using anti-PROS1 antibody (ARP56097_P050)
Product cited in: Ten Kate, Platteel, Mulder et al.: "PROS1 analysis in 87 pedigrees with hereditary protein S deficiency demonstrates striking genotype-phenotype associations." in: Human mutation, Vol. 29, Issue 7, pp. 939-47, 2008 (PubMed).

Validation Images
back to top