Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503849

Propionyl CoA Carboxylase beta Polypeptide (PCCB) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300012P06Rik, AI314687, R74805
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503849
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCCB antibody: synthetic peptide directed towards the middle region of human PCCB
Sequence PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKA YGGAYDVMSS
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against PCCB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCCB
Background PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).
Molecular Weight 58kDa
Gene ID 5096
NCBI Accession NP_000523, NM_000532
UniProt P05166
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCCB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Desviat, Clavero, Perez-Cerdá et al.: "New splicing mutations in propionic acidemia." in: Journal of human genetics, Vol. 51, Issue 11, pp. 992-7, 2006 (PubMed).

Alternatives for antigen "Propionyl CoA Carboxylase beta Polypeptide (PCCB)", type "Antibodies"
Hosts (10), (1)
Reactivities (10), (1)
Applications (11), (3), (2), (2), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon