Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503855

Ribosomal Protein L37a (RPL37A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L37A, BcDNA:RE23595, BcDNA:RH41593, CG5827, DmL37a, Dmel\\CG5827, M(2)25C, M(2)S1, RpL37a, l(2)25Cb, CG9091, Dmel\\CG9091, RpL37, RpL37A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503855
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPL37A antibody: synthetic peptide directed towards the middle region of human RPL37A
Sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKS AIRRLKELKD
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against RPL37A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPL37A
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
Molecular Weight 10kDa
Gene ID 6168
NCBI Accession NP_000989, NM_000998
UniProt P61513
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPL37A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Ribosomal Protein L37a (RPL37A)", type "Antibodies"
Hosts (9), (2)
Reactivities (10), (6), (6)
Applications (9), (6), (6), (1), (1)
Epitopes (2), (1), (1)
Beacon