Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503861

Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HPIP, Hpip
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503861
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HCFC1R1 antibody: synthetic peptide directed towards the middle region of human HCFC1R1
Sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLH NDHPYCSPPM
Predicted Reactivity Bovine : 100%, Dog : 100%, Goat : 92%, Rat : 83%
Characteristics This is a rabbit polyclonal antibody against HCFC1R1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HCFC1R1
Background HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.
Molecular Weight 15kDa
Gene ID 54985
NCBI Accession NP_001002018, NM_001002018
UniProt Q9NWW0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HCFC1R1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mahajan, Little, Vazquez et al.: "Interaction of HCF-1 with a cellular nuclear export factor." in: The Journal of biological chemistry, Vol. 277, Issue 46, pp. 44292-9, 2002 (PubMed).

Alternatives for antigen "Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (3), (2), (1)
Epitopes (4), (4), (1)
Beacon