Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503916

SNF Related Kinase (SNRK) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSNFRK, 2010012F07Rik, AI448042, AW547029, E030034B15, R74830, mKIAA0096
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503916
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNRK antibody: synthetic peptide directed towards the middle region of human SNRK
Sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEG DGGGQSKPSN
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Dog : 92%
Characteristics This is a rabbit polyclonal antibody against SNRK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SNRK
Background SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.
Molecular Weight 84kDa
Gene ID 54861
NCBI Accession NP_001094064, NM_001100594
UniProt Q9NRH2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNRK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "SNF Related Kinase (SNRK)", type "Antibodies"
Hosts (12), (3)
Reactivities (10), (4)
Applications (13), (2), (2), (2), (2), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1), (1)
Beacon