Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504065

RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GRAB, 1200014K04Rik, AI115013, C76746, Rab3ail1, Grab
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504065
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAB3IL1 antibody: synthetic peptide directed towards the middle region of human RAB3IL1
Sequence ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTK AGPRKGHSRH
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Pig : 91%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against RAB3IL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAB3IL1
Background RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
Molecular Weight 43kDa
Gene ID 5866
NCBI Accession NP_037533, NM_199229
UniProt Q8TBN0
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAB3IL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Krull, Brosius, Schmitz: "Alu-SINE exonization: en route to protein-coding function." in: Molecular biology and evolution, Vol. 22, Issue 8, pp. 1702-11, 2005 (PubMed).

Alternatives for antigen "RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1)", type "Antibodies"
Hosts (12), (3)
Reactivities (12), (3), (3), (1)
Applications (15), (5), (5), (2), (1)
Epitopes (4), (4), (2), (1), (1)
Beacon