Did you know that you can buy products from over 140 different suppliers from us?

RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1) (Middle Region) antibody

Details for Product No. ABIN504065
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GRAB, 1200014K04Rik, AI115013, C76746, Rab3ail1, Grab
Epitope
Middle Region
(8), (7), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(17), (3), (3)
Host
Rabbit
(16), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (9), (9), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504065
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RAB3IL1
Sequence ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTK AGPRKGHSRH
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Pig : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against RAB3IL1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RAB3IL1
Background RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
Molecular Weight 43 kDa
Gene ID 5866
NCBI Accession NM_199229, NP_037533
UniProt Q8TBN0
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 382 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1) (Middle Region) antibody WB Suggested Anti-RAB3IL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Background publications Krull, Brosius, Schmitz: "Alu-SINE exonization: en route to protein-coding function." in: Molecular biology and evolution, Vol. 22, Issue 8, pp. 1702-11, 2005 (PubMed).

Validation Images
back to top