Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504084

Mediator of Cell Motility 1 (MEMO1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2orf4, MEMO, NS5ATP7, 0610016J10Rik, D930048L02Rik, RGD1309929, fi04d12, zgc:55290, wu:fi04d12, MGC89105
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504084
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MEMO1 antibody: synthetic peptide directed towards the middle region of human MEMO1
Sequence AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSN LFVVSSDFCH
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Chicken : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against MEMO1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MEMO1
Background MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.
Molecular Weight 34kDa
Gene ID 51072
NCBI Accession NP_057039, NM_015934
UniProt Q9Y316
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MEMO1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Mediator of Cell Motility 1 (MEMO1)", type "Antibodies"
Hosts (8), (3)
Reactivities (8), (4), (4)
Applications (11), (6)
Epitopes (3), (2), (2), (2), (1)
Beacon