Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504089

Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CGI-70, INO80R, UCH-L5, UCH37, Uch37, 5830413B11Rik, zgc:85615, wu:fj17f09, uch37, cgi-70, DKFZp459M0513
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504089
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5
Sequence DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRF NLMAIVSDRK
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against UCHL5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UCHL5
Background UCHL5 is the deubiquitinating enzyme associated with the proteasome.
Molecular Weight 37kDa
Gene ID 51377
NCBI Accession NP_057068, NM_015984
UniProt Q9Y5K5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UCHL5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Qiu, Ouyang, Li et al.: "hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37." in: The EMBO journal, Vol. 25, Issue 24, pp. 5742-53, 2006 (PubMed).

Alternatives for antigen "Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5)", type "Antibodies"
Hosts (18), (6), (1)
Reactivities (24), (6), (2)
Applications (22), (6), (5), (1), (1), (1), (1)
Epitopes (5), (4), (3), (2), (2), (1), (1)
Beacon