Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (Middle Region) antibody

Details for Product No. ABIN504089
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CGI-70, INO80R, UCH-L5, UCH37, Uch37, 5830413B11Rik, zgc:85615, wu:fj17f09, uch37, cgi-70, DKFZp459M0513
Epitope
Middle Region
(6), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(27), (6), (3), (1)
Host
Rabbit
(22), (7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(28), (7), (6), (4), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504089
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human UCHL5
Sequence DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRF NLMAIVSDRK
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against UCHL5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UCHL5
Background UCHL5 is the deubiquitinating enzyme associated with the proteasome.
Molecular Weight 37 kDa
Gene ID 51377
NCBI Accession NM_015984, NP_057068
UniProt Q9Y5K5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 329 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) (Middle Region) antibody WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine
Background publications Qiu, Ouyang, Li et al.: "hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37." in: The EMBO journal, Vol. 25, Issue 24, pp. 5742-53, 2006 (PubMed).

Hosts (22), (7), (1)
Reactivities (27), (6), (3), (1)
Applications (28), (7), (6), (4), (4), (3), (1), (1), (1)
Epitopes (6), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top