Trafficking Protein Particle Complex 4 (TRAPPC4) (Middle Region) antibody

Details for Product No. ABIN504099
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HSPC172, PTD009, SBDN, SYNBINDIN, TRS23, Sbd, Sbdn, Sdcbp2, AI303617, 1500017G03Rik, zgc:73260, TRAPPC4, MGC131237, sbdn, trs23, ptd009, cgi-104, hspc172
Epitope
Middle Region
(4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(15), (2), (2)
Host
Rabbit
(9), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (4), (3), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504099
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRAPPC4
Sequence EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHC YQTLTGIKFV
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, African clawed frog : 90 %, Chicken : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against TRAPPC4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRAPPC4
Background TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.
Molecular Weight 24 kDa
Gene ID 51399
NCBI Accession NM_016146, NP_057230
UniProt Q9Y296
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 219 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Trafficking Protein Particle Complex 4 (TRAPPC4) (Middle Region) antibody WB Suggested Anti-TRAPPC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart
Background publications Gavin, Bösche, Krause et al.: "Functional organization of the yeast proteome by systematic analysis of protein complexes." in: Nature, Vol. 415, Issue 6868, pp. 141-7, 2002 (PubMed).

Hosts (9), (7)
Reactivities (15), (2), (2)
Applications (15), (4), (3), (3), (3), (2), (1)
Epitopes (4), (2), (1)
back to top