Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504099

Trafficking Protein Particle Complex 4 (TRAPPC4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC172, PTD009, SBDN, SYNBINDIN, TRS23, Sbd, Sbdn, Sdcbp2, AI303617, 1500017G03Rik, zgc:73260, TRAPPC4, MGC131237, sbdn, trs23, ptd009, cgi-104, hspc172
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504099
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRAPPC4 antibody: synthetic peptide directed towards the middle region of human TRAPPC4
Sequence EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHC YQTLTGIKFV
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, African clawed frog : 92%, Chicken : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against TRAPPC4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRAPPC4
Background TRAPPC4 may play a role in vesicular transport from endoplasmic reticulum to Golgi.
Molecular Weight 24kDa
Gene ID 51399
NCBI Accession NP_057230, NM_016146
UniProt Q9Y296
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRAPPC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gavin, Bösche, Krause et al.: "Functional organization of the yeast proteome by systematic analysis of protein complexes." in: Nature, Vol. 415, Issue 6868, pp. 141-7, 2002 (PubMed).

Alternatives for antigen "Trafficking Protein Particle Complex 4 (TRAPPC4)", type "Antibodies"
Hosts (10), (10)
Reactivities (19), (3), (2)
Applications (19), (8), (5), (4), (3), (2), (1), (1)
Epitopes (4), (3), (2), (1)
Beacon