Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504103

TRAPPC2L (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC176, 1810017G16Rik, AB030200, Hspc176, Tca17, RGD1304906, DDBDRAFT_0184526, DDBDRAFT_0266384, DDB_0184526, DDB_0266384, DKFZp469K0715, TRAPPC2L
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504103
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRAPPC2L antibody: synthetic peptide directed towards the N terminal of human TRAPPC2L
Sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVD EKISAMGKAL
Predicted Reactivity Chicken : 92%, Dog : 92%, Guinea pig : 92%, Pig : 92%, Zebrafish : 85%, Bovine : 84%
Characteristics This is a rabbit polyclonal antibody against TRAPPC2L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.
Molecular Weight 16kDa
Gene ID 51693
NCBI Accession NP_057293, NM_016209
UniProt Q9UL33
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRAPPC2L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "TRAPPC2L", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon