Did you know that you can buy products from over 140 different suppliers from us?

TRAPPC2L (N-Term) antibody

Details for Product No. ABIN504103
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC176, 1810017G16Rik, AB030200, Hspc176, Tca17, RGD1304906, DDBDRAFT_0184526, DDBDRAFT_0266384, DDB_0184526, DDB_0266384, DKFZp469K0715, TRAPPC2L
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504103
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRAPPC2L
Sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVD EKISAMGKAL
Predicted Reactivity Chicken : 92 %, Dog : 92 %, Guinea pig : 92 %, Pig : 92 %, Zebrafish : 82 %, Bovine : 82 %
Characteristics This is a rabbit polyclonal antibody against TRAPPC2L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.
Molecular Weight 16 kDa
Gene ID 51693
NCBI Accession NM_016209, NP_057293
UniProt Q9UL33
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 140 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TRAPPC2L (N-Term) antibody WB Suggested Anti-TRAPPC2L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504103
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top