Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504114

Calcium Binding Protein 39 (CAB39) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MO25, AA408805, AA960512, C78372, MO25alpha, CG4083, Dmel\\CG4083, Dmo25, dMo25, l(3)00274, mo25, fc06a03, zgc:86716, wu:fc06a03, MGC78903, CAB39
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504114
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CAB39 antibody: synthetic peptide directed towards the middle region of human CAB39
Sequence KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYL VKQIRDLKRP
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against CAB39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CAB39
Background Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.
Molecular Weight 40kDa
Gene ID 51719
NCBI Accession NP_057373, NM_016289
UniProt Q9Y376
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CAB39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Calcium Binding Protein 39 (CAB39)", type "Antibodies"
Hosts (13), (2)
Reactivities (9), (1), (1)
Applications (11), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Conjugates (1), (1)
Epitopes (3), (1), (1)
Beacon