Did you know that you can buy products from over 140 different suppliers from us?

XiAP Associated Factor 1 (XAF1) (Middle Region) antibody

Details for Product No. ABIN504136
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BIRC4BP, HSXIAPAF1, XIAPAF1, Fbxo39
Epitope
Middle Region
(14), (8), (7), (7), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(50), (36), (18)
Host
Rabbit
(70), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(59), (23), (19), (11), (10), (4), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504136
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human XAF1
Sequence SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISA PEREIYCHYC
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against XAF1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name XAF1
Background X-linked inhibitor of apoptosis (XIAP, MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3, M
Molecular Weight 34 kDa
Gene ID 54739
NCBI Accession NM_017523, NP_059993
UniProt Q6GPH4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 301 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-XiAP Associated Factor 1 (XAF1) (Middle Region) antibody WB Suggested Anti-XAF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Bai, Ahmad, Wang et al.: "Interferon-gamma induces X-linked inhibitor of apoptosis-associated factor-1 and Noxa expression and potentiates human vascular smooth muscle cell apoptosis by STAT3 activation." in: The Journal of biological chemistry, Vol. 283, Issue 11, pp. 6832-42, 2008 (PubMed).

Validation Images
back to top