Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504136

XiAP Associated Factor 1 (XAF1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BIRC4BP, XIAPAF1, HSXIAPAF1, Fbxo39
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504136
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1
Sequence SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISA PEREIYCHYC
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against XAF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name XAF1
Background X-linked inhibitor of apoptosis (XIAP, MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3, M
Molecular Weight 34kDa
Gene ID 54739
NCBI Accession NP_059993, NM_017523
UniProt Q6GPH4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-XAF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bai, Ahmad, Wang et al.: "Interferon-gamma induces X-linked inhibitor of apoptosis-associated factor-1 and Noxa expression and potentiates human vascular smooth muscle cell apoptosis by STAT3 activation." in: The Journal of biological chemistry, Vol. 283, Issue 11, pp. 6832-42, 2008 (PubMed).

Alternatives for antigen "XiAP Associated Factor 1 (XAF1)", type "Antibodies"
Hosts (69), (2)
Reactivities (54), (34), (20)
Applications (59), (26), (19), (11), (10), (4), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (6), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon